CoraLite® Plus 488-conjugated Neuropeptide Y Polyclonal antibody

Neuropeptide Y Polyclonal Antibody for IF-P
Cat No. CL488-12833

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

CPON, Neuropeptide tyrosine, neuropeptide Y, NPY, PYY4

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse eye tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12833 targets Neuropeptide Y in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3568

Product name: Recombinant human NPY protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-97 aa of BC029497

Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW

Predict reactive species
Full Name neuropeptide Y
Calculated Molecular Weight 97 aa, 11 kDa
GenBank Accession NumberBC029497
Gene Symbol Neuropeptide Y
Gene ID (NCBI) 4852
RRIDAB_3083932
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01303
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Neuropeptide Y (NPY) is one of the most abundant peptides in the mammalian central nervous system (CNS). NPY has been linked to several physiological and pathological functions, such as feeding behaviour, memory processing, pain, anxiety, cell proliferation and many other processes in the central and peripheral nervous systems. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. In addition, NPY was suggested as a potential neuroprotective agent in Alzheimer's disease by counteracting the toxic effect of β-amyloid in an in vitro model.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Neuropeptide Y antibody CL488-12833Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...