Neurogranin Recombinant monoclonal antibody

Neurogranin Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA

Cat No. 83593-5-RR
Clone No.240526B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), ELISA

NRGN, 240526B9, hng, NEUG(55-78), Ng

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83593-5-RR targets Neurogranin in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0676

Product name: Recombinant human NRGN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-78 aa of BC002835

Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Predict reactive species
Full Name neurogranin (protein kinase C substrate, RC3)
Calculated Molecular Weight 7.6 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC002835
Gene Symbol Neurogranin
Gene ID (NCBI) 4900
RRIDAB_3671208
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ92686
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neurogranin (formerly designated p17, also known as Ng, RC3 and BICKS) belongs to the neurogranin family. It is a neuron-specific substrate for protein kinase C (PKC). It is a postsynaptic protein that is highly enriched in brain, with restricted expression in the cortex, striatum, hippocampus, thalamus, hypothalamus and olfactory bulb nuclei. Neurogranin binds calmodulin at low levels of calcium, thereby regulating calmodulin-dependent nitric oxide synthase. Neurogranin acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. It binds to calmodulin in the absence of calcium.

Protocols

Product Specific Protocols
FC protocol for Neurogranin antibody 83593-5-RRDownload protocol
IF protocol for Neurogranin antibody 83593-5-RRDownload protocol
IHC protocol for Neurogranin antibody 83593-5-RRDownload protocol
WB protocol for Neurogranin antibody 83593-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (10-06-2025)

Neurogranin (in green) worked perfectly marking the neurons of the human FFPE brain tissue

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
Neurogranin Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:83593-5-RR)
Loading...
||
New chat

Able

正在加载,请稍候...