NeuN Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84401-4-RR (same clone as 84401-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84401-4-RR (NeuN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  WB analysis using 84401-4-RR (same clone as 84401-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84401-4-RR (NeuN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 84401-4-RR (same clone as 84401-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 84401-4-RR (NeuN antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 84401-4-RR (same clone as 84401-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 84401-4-RR (NeuN antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 84401-4-RR (same clone as 84401-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using NeuN antibody (84401-4-RR, Clone: 241461G7 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), GFAP antibody (60190-1-Ig, Clone: 4B2E10, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 84401-4-RR (same clone as 84401-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using NeuN antibody (84401-4-RR, Clone: 241461G7 ) at dilution of 1:250 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 84401-4-RR (same clone as 84401-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using NeuN antibody (84401-4-RR, Clone: 241461G7 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 84401-4-RR (same clone as 84401-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using NeuN antibody (84401-4-RR, Clone: 241461G7 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), GFAP antibody (60190-1-Ig, Clone: 4B2E10, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 84401-4-RR (same clone as 84401-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse brain tissue using NeuN antibody (84401-4-RR, Clone: 241461G7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84401-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84401-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84401-4-RR against Human NeuN were performed. The affinity constant is 0.986 nM.

NeuN antibodies are widely used as neuronal markers to identify and quantify mature neurons in brain and spinal cord tissue in neuroscience research. Proteintech has an extensive range of NeuN antibodies validated for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA and Dot blot.

Cat No. 84401-4-PBS

Clone No.241461G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, IF-Fro, Indirect ELISA

Synonyms

241461G7, Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen

---

Product Information

84401-4-PBS targets NeuN in WB, IHC, IF-P, IF-Fro, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25689

  Product name: Recombinant human NeuN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of NM_001082575

  Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR

• Full Name: hexaribonucleotide binding protein 3
• Observed Molecular Weight: 46-52 kDa
• GenBank Accession Number: NM_001082575
• Gene Symbol: NeuN
• Gene ID (NCBI): 146713
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: A6NFN3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.