Tested Applications
| Positive WB detected in | mouse cerebellum tissue, mouse brain tissue, pig brain tissue, rat cerebellum tissue, rat brain tissue |
| Positive IHC detected in | rat cerebellum tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:3000-1:12000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84401-4-RR targets NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Full Name | hexaribonucleotide binding protein 3 |
| Observed Molecular Weight | 46-52 kDa |
| GenBank Accession Number | NM_001082575 |
| Gene Symbol | NeuN |
| Gene ID (NCBI) | 146713 |
| RRID | AB_3671930 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | A6NFN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NeuN, encoded by FOX3, is a neuron-specific nuclear protein. Anti-NeuN stains exclusively neuronal cells in the central and peripheral nervous systems, especially postmitotic and differentiating neurons, as well as terminally differentiated neurons. Anti-NeuN has been used widely as a reliable tool to detect most postmitotic neuronal cell types. The immunohistochemical staining is primarily localized in the nucleus of the neurons with lighter staining in the cytoplasm.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NeuN antibody 84401-4-RR | Download protocol |
| IHC protocol for NeuN antibody 84401-4-RR | Download protocol |
| WB protocol for NeuN antibody 84401-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NeuN Recombinant monoclonal antibody (241461G7), catalog number 84401-4-RR, has 3 total citations. These appear in the British Journal of Pharmacology, Molecular Pain, and Journal of Integrative Neuroscience. The associated research fields include Parkinson's disease and neuroinflammation (CREB-Akt pathway), paclitaxel-induced neuropathic pain (TLR4 signaling), and chronic intrathecal drug delivery techniques in rats. Applications cited include immunofluorescence and Western blot in mouse and rat models.
| Species | Application | Title |
|---|---|---|
Br J Pharmacol Protective effect of scorpion-venom heat-resistant peptide (SVHRSP) against depression associated with Parkinson's disease via suppression of CREB-Akt pathway-mediated inflammation. | ||
Mol Pain Electroacupuncture at Zusanli (ST36) alleviates paclitaxel-induced neuropathic pain in rats via regulating TLR4 signaling pathway in the spinal cord. | ||
J Integr Neurosci A Novel Long-Term Intrathecal Cannulation Technique in Rats: L5-L6 Approach With Cervical Externalization for Chronic Drug Delivery. |
Reviews
What customers say
Both reviews rate the antibody 5 stars for immunofluorescence on mouse brain tissue. One user tested 50-micron cryosections of 4% PFA-fixed mouse brain and confirmed reliable performance down to a 1:5000 dilution, with all concentrations working very well. The other user simply noted it works very well. Overall, customers report strong, consistent staining results in brain tissue applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Noelia (Verified Customer) (08-27-2026) | It works so good
|
Philip (Verified Customer) (12-18-2025) | 50 micron cryosections of 4% paraformaldehyde fixed mouse brain. Tested downn to 1:5000 dilution and all concentrations worked very well.
|
