Tested Applications
Positive IF-P detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL555-84401-4 targets NeuN in IF-P applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
Full Name | hexaribonucleotide binding protein 3 |
Observed Molecular Weight | 46-52 kDa |
GenBank Accession Number | NM_001082575 |
Gene Symbol | NeuN |
Gene ID (NCBI) | 146713 |
Conjugate | CoraLite® Plus 555 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 554 nm / 570 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | A6NFN3 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 555 NeuN antibody CL555-84401-4 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |