Tested Applications
| Positive WB detected in | mouse cerebellum tissue, pig brain tissue, rat cerebellum tissue, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:3000-1:12000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84401-4-RR targets NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Full Name | hexaribonucleotide binding protein 3 |
| Observed Molecular Weight | 46-52 kDa |
| GenBank Accession Number | NM_001082575 |
| Gene Symbol | NeuN |
| Gene ID (NCBI) | 146713 |
| RRID | AB_3671930 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | A6NFN3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NeuN antibody 84401-4-RR | Download protocol |
| IHC protocol for NeuN antibody 84401-4-RR | Download protocol |
| WB protocol for NeuN antibody 84401-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Philip (Verified Customer) (12-18-2025) | 50 micron cryosections of 4% paraformaldehyde fixed mouse brain. Tested downn to 1:5000 dilution and all concentrations worked very well.
|















