CoraLite® Plus 488-conjugated Neuroserpin Monoclonal antibody

Neuroserpin Monoclonal Antibody for IF/ICC
Cat No. CL488-66997
Clone No.1G4C6

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

IF/ICC

Serpin I1, PI-12, PI12, PI 12, Peptidase inhibitor 12

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inU-251 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66997 targets Neuroserpin in IF/ICC applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28636

Product name: Recombinant human SERPINI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 109-410 aa of BC018043

Sequence: ANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL

Predict reactive species
Full Name serpin peptidase inhibitor, clade I (neuroserpin), member 1
Calculated Molecular Weight 410 aa, 47 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC018043
Gene Symbol Neuroserpin
Gene ID (NCBI) 5274
RRIDAB_3672932
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99574
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Neuroserpin antibody CL488-66997Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...