Tested Applications
| Positive IF/ICC detected in | U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-66997 targets Neuroserpin in IF/ICC applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28636 Product name: Recombinant human SERPINI1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 109-410 aa of BC018043 Sequence: ANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL Predict reactive species |
| Full Name | serpin peptidase inhibitor, clade I (neuroserpin), member 1 |
| Calculated Molecular Weight | 410 aa, 47 kDa |
| Observed Molecular Weight | 46 kDa |
| GenBank Accession Number | BC018043 |
| Gene Symbol | Neuroserpin |
| Gene ID (NCBI) | 5274 |
| RRID | AB_3672932 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99574 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system, such as s the cerebral cortex, hippocampus and the spinal cord.Neuroserpin exerts protective effects in neurons against excitotoxicity both in vitro and in vivo. Its proteolytic inhibitory activity is shown to protect neurons against damage caused by plasmin activation. Mice overexpressing neuroserpin exhibited loss of tPA activity in the brain. Overexpression of neuroserpin in primary neurons leads to increased dendritic arborization and altered dendritic spine shape.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 Neuroserpin antibody CL488-66997 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

