ORM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ORM1 Polyclonal antibody, PBS Only (16439-1-PBS)

• 

  WB analysis using 16439-1-AP (same clone as 16439-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16439-1-AP (ORM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse bladder using 16439-1-AP (same clone as 16439-1-PBS)

  mouse bladder tissue were subjected to SDS PAGE followed by western blot with 16439-1-AP (ORM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  IP experiment of human plasma using 16439-1-AP (same clone as 16439-1-PBS)

  IP result of anti-ORM1 (IP:16439-1-AP, 3ug; Detection:16439-1-AP 1:300) with human plasma lysate 100ug. This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16439-1-AP (same clone as 16439-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16439-1-AP (ORM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 16439-1-AP (same clone as 16439-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16439-1-AP (ORM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 16439-1-AP (same clone as 16439-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 16439-1-AP (ORM1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16439-1-AP (same clone as 16439-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16439-1-AP (ORM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 16439-1-AP (same clone as 16439-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16439-1-AP (ORM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16439-1-AP (same clone as 16439-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ORM1 antibody (16439-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 16439-1-AP (same clone as 16439-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug ORM1 Polyclonal antibody (16439-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Rabbit IgG control Rabbit PolyAb (30000-0-AP) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 16439-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ORM1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 16439-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

---

Product Information

16439-1-PBS targets ORM1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9758

  Product name: Recombinant human ORM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-201 aa of BC026238

  Sequence: NLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES

• Full Name: orosomucoid 1
• Calculated Molecular Weight: 201 aa, 24 kDa
• Observed Molecular Weight: 40-47 kDa
• GenBank Accession Number: BC026238
• Gene Symbol: ORM1
• Gene ID (NCBI): 5004
• RRID: AB_2878259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02763
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Alpha-1-acid glycoprotein 1 (AGP1), also called orosomucoid-1 (ORM1), is a glycoprotein synthesized mostly by hepatocytes and present in human plasma. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in human plasma which may be due to the glycosylation of ORM1 or the dimer formation of the protein.