CoraLite® Plus 488-conjugated P15RS Polyclonal antibody

• 

  IF Staining of HeLa using CL488-23652

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 P15RS antibody (CL488-23652) at dilution of 1:200, CL594-phalloidin (red).

• 

  IF Staining of HepG2 using CL488-23652

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 P15RS antibody (CL488-23652) at dilution of 1:200, CL594-phalloidin (red).

• 

  FC experiment of HeLa using CL488-23652

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488-conjugated P15RS Polyclonal antibody (CL488-23652)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

P15RS Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-23652

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

HsT3101, p15INK4B related protein, P15RS, RPRD1A

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, HepG2 cells
• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-23652 targets P15RS in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20409

  Product name: Recombinant human P15RS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 82-167 aa of BC010136

  Sequence: APVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLV

• Full Name: regulation of nuclear pre-mRNA domain containing 1A
• Calculated Molecular Weight: 312 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC010136
• Gene Symbol: RPRD1A
• Gene ID (NCBI): 55197
• RRID: AB_3672757
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P16
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RPRD1A is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) and may have a role in cell cycle regulation. It contains a RAR domain that is involved in regulation of nuclear pre-mRNA, which suggests that P15RS may act as a nuclear regulation protein [PMID:12470661]. It also interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. Besides, RPRD1A regulates cell cycle genes and attenuates WNT signaling [PMID: 20739273], and acts as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle [PMID: 22231121].