Tested Applications
Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Positive FC (Intra) detected in | HeLa cells |
Positive FC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
Flow Cytometry (FC) | FC : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-23652 targets P15RS in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20409 Product name: Recombinant human P15RS protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 82-167 aa of BC010136 Sequence: APVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLV Predict reactive species |
Full Name | regulation of nuclear pre-mRNA domain containing 1A |
Calculated Molecular Weight | 312 aa, 36 kDa |
Observed Molecular Weight | 36 kDa |
GenBank Accession Number | BC010136 |
Gene Symbol | RPRD1A |
Gene ID (NCBI) | 55197 |
RRID | AB_3672757 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96P16 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
RPRD1A is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) and may have a role in cell cycle regulation. It contains a RAR domain that is involved in regulation of nuclear pre-mRNA, which suggests that P15RS may act as a nuclear regulation protein [PMID:12470661]. It also interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. Besides, RPRD1A regulates cell cycle genes and attenuates WNT signaling [PMID: 20739273], and acts as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle [PMID: 22231121].
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 P15RS antibody CL488-23652 | Download protocol |
FC protocol for CL Plus 488 P15RS antibody CL488-23652 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |