• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated P15RS Polyclonal antibody

P15RS Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-23652

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

RPRD1A, Cyclin-dependent kinase inhibitor 2B-related protein, HsT3101, p15INK4B related protein, p15INK4B-related protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells, HepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-23652 targets P15RS in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20409

Product name: Recombinant human P15RS protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 82-167 aa of BC010136

Sequence: APVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLV

Predict reactive species
Full Name regulation of nuclear pre-mRNA domain containing 1A
Calculated Molecular Weight 312 aa, 36 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC010136
Gene Symbol RPRD1A
Gene ID (NCBI) 55197
RRIDAB_3672757
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96P16
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RPRD1A is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) and may have a role in cell cycle regulation. It contains a RAR domain that is involved in regulation of nuclear pre-mRNA, which suggests that P15RS may act as a nuclear regulation protein [PMID:12470661]. It also interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. Besides, RPRD1A regulates cell cycle genes and attenuates WNT signaling [PMID: 20739273], and acts as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle [PMID: 22231121].

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 P15RS antibody CL488-23652Download protocol
IF protocol for CL Plus 488 P15RS antibody CL488-23652Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...