Tested Applications
| Positive IF/ICC detected in | SKOV-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-80756 targets PAX8 in IF/ICC applications and shows reactivity with Human, mouse samples.
| Tested Reactivity | Human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0306 Product name: Recombinant human PAX8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC001060 Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS Predict reactive species |
| Full Name | paired box 8 |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 48 kDa, 58 kDa |
| GenBank Accession Number | BC001060 |
| Gene Symbol | PAX8 |
| Gene ID (NCBI) | 7849 |
| RRID | AB_3084490 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q06710 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinoma.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 PAX8 antibody CL488-80756 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

