PAX8 Recombinant monoclonal antibody

PAX8 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 80756-1-RR
Clone No.6B14

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

PAX-8, 6B14, paired box 8, Paired box protein Pax 8, Paired box protein Pax-8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, rat kidney tissue
Positive IHC detected inhuman ovary tumor tissue, human ovary cancer tissue, human renal cell carcinoma tissue, human thyroid cancer tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSKOV-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)/ICCIF/ICC : 1:650-1:2600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80756-1-RR targets PAX8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0306

Product name: Recombinant human PAX8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC001060

Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS

Predict reactive species
Full Name paired box 8
Calculated Molecular Weight 48 kDa
Observed Molecular Weight48 kDa, 58 kDa
GenBank Accession NumberBC001060
Gene Symbol PAX8
Gene ID (NCBI) 7849
RRIDAB_2923693
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ06710
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinoma.

Protocols

Product Specific Protocols
IF protocol for PAX8 antibody 80756-1-RRDownload protocol
IHC protocol for PAX8 antibody 80756-1-RRDownload protocol
WB protocol for PAX8 antibody 80756-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Melek (Verified Customer) (09-18-2025)

It was used for immunoflourescence for organoids and it worked well.

  • Applications: Immunofluorescence
  • Cell Tissue Type: 3D in vitro model
Loading...
||
New chat

Able

正在加载,请稍候...