"PCNA Antibodies" Comparison
View side-by-side comparison of PCNA antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, C6 cells, ROS1728 cells, NIH/3T3 cells, 3T3-L1 cells, 4T1 cells, RAW 264.7 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human gliomas tissue, human breast cancer tissue, human liver cancer tissue, human placenta tissue, human tonsillitis tissue, mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 123 publications below |
| IHC | See 50 publications below |
| IF | See 36 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
60097-1-Ig targets PCNA in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, rabbit, zebrafish |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7416 Product name: Recombinant human PCNA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 8-256 aa of BC000491 Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE Predict reactive species |
| Full Name | proliferating cell nuclear antigen |
| Calculated Molecular Weight | 29 kDa/31 kDa |
| Observed Molecular Weight | 36-38 kDa |
| GenBank Accession Number | BC000491 |
| Gene Symbol | PCNA |
| Gene ID (NCBI) | 5111 |
| RRID | AB_2236728 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P12004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Proliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PCNA antibody 60097-1-Ig | Download protocol |
| IHC protocol for PCNA antibody 60097-1-Ig | Download protocol |
| IP protocol for PCNA antibody 60097-1-Ig | Download protocol |
| WB protocol for PCNA antibody 60097-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun USP52 acts as a deubiquitinase and promotes histone chaperone ASF1A stabilization. | ||
Nat Commun Cyclophilin J limits inflammation through the blockage of ubiquitin chain sensing. | ||
Microbiome Antioxidant potential of Pediococcus pentosaceus strains from the sow milk bacterial collection in weaned piglets. | ||
Nat Cardiovasc Res Endocardial primary cilia and blood flow regulate EndoMT during endocardial cushion development | ||
Environ Pollut Wnt10a downregulation contributes to MEHP-induced disruption of self-renewal and differentiation balance and proliferation inhibition in GC-1 cells: Insights from multiple transcriptomic profiling | ||
Acta Pharmacol Sin PU.1/Spi1 exacerbates ischemia-reperfusion induced acute kidney injury via upregulating Gata2 and promoting fibroblast activation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Julia (Verified Customer) (08-12-2024) | Really good, specific antibody! Incubated over night at 4C; 1:10000 dilution in 3% milk.
![]() |
FH Tsimafei (Verified Customer) (08-04-2024) | Excellent antibody. Membrane was incubated at 4C, ON
![]() |
FH Andrea (Verified Customer) (01-11-2023) | primary antibody were incubated at 4C, ON. Antibody provide a specific signal for mouse Pcna protein
![]() |
FH Hasan (Verified Customer) (11-04-2022) | U2OS cells fixed with Methanol:Aceton (7:3), 20 min, 4 degrees. Blocked for 1h with 5% FBS in Triton-x 0.1% Stained with the anti-PCNA (60097-1-Ig) (1:200) O/N @4 degress
![]() |
FH Maria (Verified Customer) (08-07-2021) | PCNA in human primary fibroblasts in culture. Passage number 15-25. 15 ug of protein. 4-15% TGX gel. Blocking BSA 3% in PBST. Primary ab 1:1000 in BSA O/N 4ºC. Secondary ab 1:5000 HRP.
![]() |












































