Filter:
  • Western Blot (WB) analysis of HeLa cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HeLa using 60097-1-Ig

    Western blot analysis of PCNA in various cell lines using Proteintech antibody 60097-1-Ig at a dilution of 1:10000 (exposed for 2 seconds) incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HEK-293 cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HEK-293 using 60097-1-Ig

    HEK-293 cells were subjected to SDS PAGE followed by western blot with 60097-1-Ig (PCNA Antibody) at various dilution incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of HEK-293 cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HEK-293 using 60097-1-Ig

    WB result of PCNA antibody (60097-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PCNA transfected HEK-293 cells.

  • Western Blot (WB) analysis of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HepG2 using 60097-1-Ig

    HepG2 cells were subjected to SDS PAGE followed by western blot with 60097-1-Ig (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    IP experiment of HepG2 using 60097-1-Ig

    IP result of anti-PCNA (IP:60097-1-Ig, 4ug; Detection:60097-1-Ig 1:300) with HepG2 cells lysate 3000ug.

  • Immunohistochemistry (IHC) staining of human gliomas tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human gliomas using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human liver cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human liver cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human placenta tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human placenta using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human gliomas tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human gliomas using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse ovary tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of mouse ovary using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse ovary tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of mouse ovary using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer using 60097-1-Ig(PCNA antibody) at dilution of 1:800 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer using 60097-1-Ig(PCNA antibody) at dilution of 1:800 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human tonsillitis tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human tonsillitis using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human tonsillitis tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human tonsillitis using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    IF Staining of HepG2 using 60097-1-Ig

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 60097-1-Ig (PCNA antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    IF Staining of HepG2 using 60097-1-Ig

    Immunofluorescent analysis of (10% Formaldehyde ) fixed HepG2 cells using 60097-1-Ig(PCNA antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of mouse heart tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IF Staining of mouse heart using 60097-1-Ig

    E14.5 FFPE mouse heart stained for Desmin (green, Cat. No CL488-16520) and PCNA (red, Cat. No 60097-1-Ig). Desmin was conjugated to CoraLite-488 fluorescent dye and stains cardiomyocytes (heart muscle cells). PCNA stains proliferating cells, which are numerous in the developing heart. In this image, the four chambers of the heart can be easily visualized. Image credit: @Immunofluorescence on Instagram.

"PCNA Antibodies" Comparison

View side-by-side comparison of PCNA antibodies from other vendors to find the one that best suits your research needs.
  • Featured Product
  • KD/KO Validated

PCNA Monoclonal antibody

PCNA Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 60097-1-Ig
Clone No.10D10E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

10D10E11, Cyclin, proliferating cell nuclear antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, C6 cells, ROS1728 cells, NIH/3T3 cells, 3T3-L1 cells, 4T1 cells, RAW 264.7 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman gliomas tissue, human breast cancer tissue, human liver cancer tissue, human placenta tissue, human tonsillitis tissue, mouse ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, mouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60097-1-Ig targets PCNA in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, rabbit, zebrafish
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7416

Product name: Recombinant human PCNA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 8-256 aa of BC000491

Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE

Predict reactive species
Full Name proliferating cell nuclear antigen
Calculated Molecular Weight 29 kDa/31 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC000491
Gene Symbol PCNA
Gene ID (NCBI) 5111
RRIDAB_2236728
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP12004
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).

Protocols

Product Specific Protocols
IF protocol for PCNA antibody 60097-1-IgDownload protocol
IHC protocol for PCNA antibody 60097-1-IgDownload protocol
IP protocol for PCNA antibody 60097-1-IgDownload protocol
WB protocol for PCNA antibody 60097-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Commun

USP52 acts as a deubiquitinase and promotes histone chaperone ASF1A stabilization.

Authors - Shangda Yang
humanWB

Nat Commun

Cyclophilin J limits inflammation through the blockage of ubiquitin chain sensing.

Authors - Chunjie Sheng
pigWB

Microbiome

Antioxidant potential of Pediococcus pentosaceus strains from the sow milk bacterial collection in weaned piglets.

Authors - Leli Wang
mouseIF

Nat Cardiovasc Res

Endocardial primary cilia and blood flow regulate EndoMT during endocardial cushion development

Authors - Kathryn Berg
rat,mouseWB,IF

Environ Pollut

Wnt10a downregulation contributes to MEHP-induced disruption of self-renewal and differentiation balance and proliferation inhibition in GC-1 cells: Insights from multiple transcriptomic profiling

Authors - Yifan Hong
mouseWB

Acta Pharmacol Sin

PU.1/Spi1 exacerbates ischemia-reperfusion induced acute kidney injury via upregulating Gata2 and promoting fibroblast activation

Authors - Chen Zong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Julia (Verified Customer) (08-12-2024)

Really good, specific antibody! Incubated over night at 4C; 1:10000 dilution in 3% milk.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mouse embryonic stem cells
PCNA Antibody Western Blot validation (1:10000 dilution) in mouse embryonic stem cells (Cat no:60097-1-Ig)
FH

Tsimafei (Verified Customer) (08-04-2024)

Excellent antibody. Membrane was incubated at 4C, ON

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mESCs
PCNA Antibody Western Blot validation (1:10000 dilution) in mESCs (Cat no:60097-1-Ig)
FH

Andrea (Verified Customer) (01-11-2023)

primary antibody were incubated at 4C, ON. Antibody provide a specific signal for mouse Pcna protein

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mESCs
PCNA Antibody Western Blot validation (1:5000 dilution) in mESCs (Cat no:60097-1-Ig)
FH

Hasan (Verified Customer) (11-04-2022)

U2OS cells fixed with Methanol:Aceton (7:3), 20 min, 4 degrees. Blocked for 1h with 5% FBS in Triton-x 0.1% Stained with the anti-PCNA (60097-1-Ig) (1:200) O/N @4 degress

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: U2OS WT
PCNA Antibody Immunofluorescence validation (1:200 dilution) in U2OS WT (Cat no:60097-1-Ig)
FH

Maria (Verified Customer) (08-07-2021)

PCNA in human primary fibroblasts in culture. Passage number 15-25. 15 ug of protein. 4-15% TGX gel. Blocking BSA 3% in PBST. Primary ab 1:1000 in BSA O/N 4ºC. Secondary ab 1:5000 HRP.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: human primary fibroblasts
PCNA Antibody Western Blot validation (1:1000 dilution) in human primary fibroblasts (Cat no:60097-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...