PDGFRL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDGFRL Polyclonal antibody (16217-1-AP)

PDGFRL Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 16217-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

PDGF receptor beta-like tumor suppressor, PDGFR like protein, PDGFR-like protein, PDGRL, Platelet-derived growth factor receptor-like protein

• 

  WB analysis of L02 using 16217-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 16217-1-AP (PDGFRL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 16217-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16217-1-AP (PDGFRL Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16217-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16217-1-AP (PDGFRL Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16217-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16217-1-AP (PDGFRL Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 16217-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16217-1-AP (PDGFRL Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 16217-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16217-1-AP (PDGFRL Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of L02 using 16217-1-AP

  Immunofluorescent analysis of L02 cells using 16217-1-AP (PDGFRL antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 16217-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug PDGFRL Polyclonal antibody (16217-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDGFRL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: L02 cells, mouse liver tissue
• Positive IHC detected in: human liver cancer tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: L02 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16217-1-AP targets PDGFRL in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9218

  Product name: Recombinant human PDGFRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-375 aa of BC010927

  Sequence: MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTVATTVEFS

• Full Name: platelet-derived growth factor receptor-like
• Calculated Molecular Weight: 375 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC010927
• Gene Symbol: PDGFRL
• Gene ID (NCBI): 5157
• RRID: AB_2878230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15198
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

PDGFRL Polyclonal antibody (Cat# 16217-1-AP) has 3 citations. The journals are Nature Communications, Molecular Carcinogenesis, and Aging (Albany NY). Research fields include inflammatory fibrosis resolution in frozen shoulder capsule, antitumor effects of regorafenib combined with radiotherapy in hepatocellular carcinoma, and T cell-related gene signature identification in gastric cancer. Applications cited: WB and IHC in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; A single cell atlas of frozen shoulder capsule identifies features associated with inflammatory fibrosis resolution; Authors - Michael T H Ng
human	IHC	Mol Carcinog; The cumulative antitumor effects of regorafenib and radiotherapy in hepatocellular carcinoma; Authors - Shuwen Kuang
human	WB	Aging (Albany NY); Identification of a unique stress response state of T cells-related gene signature in patients with gastric cancer; Authors - Qin Yang ; KD Validated