PEA15 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83958-2-RR (same clone as 83958-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83958-2-RR (PEA15 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83958-2-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 83958-2-RR (same clone as 83958-2-PBS)

  WB result of PEA15 antibody (83958-2-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-PEA15 transfected COLO 320 cells. This data was developed using the same antibody clone with 83958-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00916-1

  Cytometric bead array standard curve of MP00916-1, PEA15 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83958-2-PBS. Detection antibody: 83958-1-PBS. Standard: Ag13782. Range: 3.125-200 ng/mL.

• 

  Affinity and Kinetic Characterization of 83958-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83958-2-RR against Human PEA15 were performed. The affinity constant is 0.306 nM.

• Featured Product
• KD/KO Validated

PEA15 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83958-2-PBS

Clone No.241044G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

241044G8, Astrocytic phosphoprotein PEA-15, HMAT1, HUMMAT1H, MAT1

---

Product Information

83958-2-PBS targets PEA15 as part of a matched antibody pair:

MP00916-1: 83958-2-PBS capture and 83958-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13782

  Product name: Recombinant human PEA15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-130 aa of BC002426

  Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

• Full Name: phosphoprotein enriched in astrocytes 15
• Calculated Molecular Weight: 130 aa, 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC002426
• Gene Symbol: PEA15
• Gene ID (NCBI): 8682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15121
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phosphoprotein Enriched in Astrocytes 15 kDa (PEA15), also known as PED-15, is a small, death effector-domain (DED)-containing protein that was recently demonstrated to inhibit tumor necrosis factor-α-induced apoptosis and to reverse the inhibition of integrin activation due to H-Ras. PEA15 is a 15 kDa protein that is highly expressed in the nervous system with particularly high levels in astrocytes and neurons of the hippocampus. PEA15 is a cytoplasmic protein that sits at an important junction in intracellular signalling and can regulate diverse cellular processes, such as proliferation and apoptosis, dependent upon stimulation.