PEA15 Recombinant monoclonal antibody

• 

  WB analysis using 83958-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83958-2-RR (PEA15 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 83958-2-RR

  WB result of PEA15 antibody (83958-2-RR; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-PEA15 transfected COLO 320 cells.

• 

  Affinity and Kinetic Characterization of 83958-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83958-2-RR against Human PEA15 were performed. The affinity constant is 0.306 nM.

• Featured Product
• KD/KO Validated

PEA15 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83958-2-RR

Clone No.241044G8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

MAT1H, MAT1, HUMMAT1H, HMAT1, Astrocytic phosphoprotein PEA-15

---

Tested Applications

• Positive WB detected in: C6 cells, COLO 320 cells, Neuro-2a cells, SH-SY5Y cells, U-87 MG cells, fetal human brain tissue, mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83958-2-RR targets PEA15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13782

  Product name: Recombinant human PEA15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-130 aa of BC002426

  Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

• Full Name: phosphoprotein enriched in astrocytes 15
• Calculated Molecular Weight: 130 aa, 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC002426
• Gene Symbol: PEA15
• Gene ID (NCBI): 8682
• RRID: AB_3671535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15121
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Phosphoprotein Enriched in Astrocytes 15 kDa (PEA15), also known as PED-15, is a small, death effector-domain (DED)-containing protein that was recently demonstrated to inhibit tumor necrosis factor-α-induced apoptosis and to reverse the inhibition of integrin activation due to H-Ras. PEA15 is a 15 kDa protein that is highly expressed in the nervous system with particularly high levels in astrocytes and neurons of the hippocampus. PEA15 is a cytoplasmic protein that sits at an important junction in intracellular signalling and can regulate diverse cellular processes, such as proliferation and apoptosis, dependent upon stimulation.