CoraLite® Plus 488-conjugated PER2 (isoform 1) Monoclonal antibody

PER2 (isoform 1) Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67513
Clone No.2E6C3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

PER2, 2E6C3, FASPS, hPER2, PER 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67513 targets PER2 (isoform 1) in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29489

Product name: Recombinant human PER2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 740-839 aa of NM_022817

Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS

Predict reactive species
Full Name period homolog 2 (Drosophila)
Calculated Molecular Weight 137 kDa
Observed Molecular Weight150~160 kDa
GenBank Accession NumberNM_022817
Gene Symbol PER2
Gene ID (NCBI) 8864
RRIDAB_3672951
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15055
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PER2 (isoform 1) antibody CL488-67513Download protocol
IF protocol for CL Plus 488 PER2 (isoform 1) antibody CL488-67513Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...