Tested Applications
Positive IF/ICC detected in | HepG2 cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-67513 targets PER2 (isoform 1) in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29489 Product name: Recombinant human PER2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 740-839 aa of NM_022817 Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS Predict reactive species |
Full Name | period homolog 2 (Drosophila) |
Calculated Molecular Weight | 137 kDa |
Observed Molecular Weight | 150~160 kDa |
GenBank Accession Number | NM_022817 |
Gene Symbol | PER2 |
Gene ID (NCBI) | 8864 |
RRID | AB_3672951 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O15055 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 PER2 (isoform 1) antibody CL488-67513 | Download protocol |
FC protocol for CL Plus 488 PER2 (isoform 1) antibody CL488-67513 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |