Tested Applications
| Positive IF/ICC detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67390 targets Profilin 1 in IF/ICC applications and shows reactivity with Human, Mouse, Rat samples.
| Tested Reactivity | Human, Mouse, Rat | 
| Host / Isotype | Mouse / IgG2b | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag29206 Product name: Recombinant human PFN1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006768 Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY Predict reactive species | 
                                    
| Full Name | profilin 1 | 
| Calculated Molecular Weight | 140 aa, 15 kDa | 
| Observed Molecular Weight | 13 kDa | 
| GenBank Accession Number | BC006768 | 
| Gene Symbol | Profilin 1 | 
| Gene ID (NCBI) | 5216 | 
| RRID | AB_2920125 | 
| Conjugate | CoraLite®594 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | P07737 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Profilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 Profilin 1 antibody CL594-67390 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

