Profilin 1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Profilin 1 Monoclonal antibody (67390-1-Ig)

• Featured Product
• KD/KO Validated

Profilin 1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67390-1-Ig Copied!

Clone No. 3A12E8

Publications (6)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PFN1, 3A12E8, ALS18, PFN 1, Profilin I

• 

  WB analysis using 67390-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67390-1-Ig (Profilin 1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67390-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67390-1-Ig (Profilin 1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67390-1-Ig

  WB result of Profilin 1 antibody (67390-1-Ig; 1:160000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Profilin 1 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HAP1 using 67390-1-Ig

  HAP1 (WT and PFN1 KO) lysates prepared with NP-40 buffer, 50 μg protein loaded. 67390-1-lg  incubated at 1:30,000 at 4°C overnight in 5% milk in TBST. Ponceau stained transfers shown on right. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

• 

  IHC staining of human colon cancer using 67390-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67390-1-Ig (Profilin 1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67390-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Profilin 1 antibody (67390-1-Ig, Clone: 3A12E8 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HAP1 using 67390-1-Ig

  HAP1 WT cells (green outline) and PFN1 KO cells (magenta outline) labelled with a green or a far-red fluorescence dye, respectively. Cells with 4% PFA and stained with 67390-1-lg at 1.0 μg/ml plus DAPI. Bars = 10 μm. Data provided by YCharOS, an open science company with a mission to validate commercial antibodies to improve scientific reproducibility and transparency.

Able AI

What's the best dilution for Profilin 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LNCaP cells, HAP1, HSC-T6 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, Neuro-2a cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HAP1 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:4000-1:16000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67390-1-Ig targets Profilin 1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29206

  Product name: Recombinant human PFN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-140 aa of BC006768

  Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY

• Full Name: profilin 1
• Calculated Molecular Weight: 140 aa, 15 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC006768
• Gene Symbol: Profilin 1
• Gene ID (NCBI): 5216
• RRID: AB_2882634
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07737
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Profilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance.

Publications

What published studies show

Anti-Profilin-1 (Cat# 67390-1-Ig) has 6 total citations published in Cell Death Discovery, Cell Proliferation, iScience, Journal of Biological Chemistry, Diabetes Metabolic Syndrome and Obesity, and F1000Research. Research fields span oocyte biology, lung adenocarcinoma immunotherapy prediction, nuclear fractionation methods, profilin1-associated ALS, diabetic nephropathy via Hedgehog signaling, and antibody performance validation for WB, IP, and IF applications.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF	Cell Death Discov; Zona pellucida is required for oocyte actin cortex and oocyte-somatic cell interactions during oocyte growth.; Authors - Shoujing Liang
human	IF	Cell Prolif; An artificial intelligence network-guided signature for predicting outcome and immunotherapy response in lung adenocarcinoma patients based on 26 machine learning algorithms; Authors - Nan Zhang
human	WB,IF	iScience; Methods to separate nuclear soluble fractions reflecting localizations in living cells; Authors - Yutaka Ogawa
	WB	J Biol Chem; Abnormal regulation of membrane-less organelles contributes to profilin1-associated ALS; Authors - Guoqiang Ma ; KD Validated
human	WB	Diabetes Metab Syndr Obes; Profilin1 Promotes Renal Tubular Epithelial Cell Apoptosis in Diabetic Nephropathy Through the Hedgehog Signaling Pathway; Authors - Liping Mai
human	WB,IP,IF	F1000Res; The identification of high-performing antibodies for Profilin-1 for use in Western blot, immunoprecipitation and immunofluorescence; Authors - Riham Ayoubi ; KO Validated