• Featured Product
  • KD/KO Validated

Prohibitin 2 Polyclonal antibody

Prohibitin 2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 12295-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA, Electrochemical Immunosensor

PHB2, BAP, B-cell receptor-associated protein BAP37, D prohibitin, D-prohibitin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells
Positive IP detected inHeLa cells, mouse brain tissue
Positive IHC detected inhuman heart tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12295-1-AP targets Prohibitin 2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA, Electrochemical Immunosensor applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, rice
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2977

Product name: Recombinant human PHB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-299 aa of BC014766

Sequence: MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Predict reactive species
Full Name prohibitin 2
Calculated Molecular Weight 299 aa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC014766
Gene Symbol Prohibitin 2
Gene ID (NCBI) 11331
RRIDAB_2164779
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99623
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PHB2, also named as BAP, REA, D-prohibitin, BAP37 and Prohibitin-2, belongs to the prohibitin family. It acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. PHB2 functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. PHB2 is probably involved in regulating mitochondrial respiration activity and in aging.(PMID: 10359819)

Protocols

Product Specific Protocols
FC protocol for Prohibitin 2 antibody 12295-1-APDownload protocol
IF protocol for Prohibitin 2 antibody 12295-1-APDownload protocol
IHC protocol for Prohibitin 2 antibody 12295-1-APDownload protocol
IP protocol for Prohibitin 2 antibody 12295-1-APDownload protocol
WB protocol for Prohibitin 2 antibody 12295-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria

Authors - Sabine Poerschke
humanWB

J Am Soc Nephrol

Bif-1 Interacts with Prohibitin-2 to Regulate Mitochondrial Inner Membrane during Cell Stress and Apoptosis.

Authors - Sung-Gyu Cho
mouseWB

Neuron

Oligodendrocytes enhance axonal energy metabolism by deacetylation of mitochondrial proteins through transcellular delivery of SIRT2.

Authors - Kelly A Chamberlain
ratIF

Nat Commun

Spatial mapping of juxtacrine axo-glial interactions identifies novel molecules in peripheral myelination.

Authors - Y Poitelon
mouse

Redox Biol

PHB2 ameliorates Doxorubicin-induced cardiomyopathy through interaction with NDUFV2 and restoration of mitochondrial complex I function

Authors - Mingjie Yang
humanIF

J Exp Clin Cancer Res

PHB2 promotes SHIP2 ubiquitination via the E3 ligase NEDD4 to regulate AKT signaling in gastric cancer

Authors - Liang Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sara (Verified Customer) (10-10-2024)

It works well in immunofluorescence using mouse primary lymphocytes. It localises to the mitochondria.

  • Applications: Immunofluorescence
Prohibitin 2 Antibody Immunofluorescence validation ( dilution) in (Cat no:12295-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...