• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated Prohibitin 2 Polyclonal antibody

Prohibitin 2 Polyclonal Antibody for FC (Intra)
Cat No. CL488-12295

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

PHB2, BAP, B-cell receptor-associated protein BAP37, D prohibitin, D-prohibitin

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-12295 targets Prohibitin 2 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2977

Product name: Recombinant human PHB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-299 aa of BC014766

Sequence: MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Predict reactive species
Full Name prohibitin 2
Calculated Molecular Weight 299 aa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC014766
Gene Symbol Prohibitin 2
Gene ID (NCBI) 11331
RRIDAB_3672533
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99623
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PHB2, also named as BAP, REA, D-prohibitin, BAP37 and Prohibitin-2, belongs to the prohibitin family. It acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. PHB2 functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. It competes with NCOA1 for modulation of ER transcriptional activity. PHB2 is probably involved in regulating mitochondrial respiration activity and in aging.(PMID: 10359819)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Prohibitin 2 antibody CL488-12295Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

lu (Verified Customer) (09-18-2025)

Good antibody for flow cytometry

  • Applications: Flow Cytometry
  • Primary Antibody Dilution: 1:200
Loading...
||
New chat

Able

正在加载,请稍候...