PI3 Kinase p110 Beta Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PI3 Kinase p110 Beta Monoclonal antibody (67121-1-Ig)

PI3 Kinase p110 Beta Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67121-1-Ig

Clone No.1B2A1

Publications(41)

Host / Isotype

Mouse / IgG1

Reactivity

human, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PI3K p110(beta), PIK3CB, 1B2A1, EC:2.7.1.153, EC:2.7.11.1

• 

  WB analysis using 67121-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 67121-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67121-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 67121-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67121-1-Ig (PIK3CB antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67121-1-Ig (PIK3CB antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 67121-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67121-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PI3 Kinase p110 Beta antibody (67121-1-Ig, Clone: 1B2A1 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells, PC-12 cells
• Positive IHC detected in: human lung cancer tissue, human colon cancer tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67121-1-Ig targets PI3 Kinase p110 Beta in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse, rat, chicken, goat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17505

  Product name: Recombinant human PIK3CB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 139-373 aa of BC114432

  Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV

• Full Name: phosphoinositide-3-kinase, catalytic, beta polypeptide
• Calculated Molecular Weight: 1070 aa, 123 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC114432
• Gene Symbol: PI3 Kinase p110 Beta
• Gene ID (NCBI): 5291
• RRID: AB_2882424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P42338
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Metab; Maternal exercise prevents metabolic disorders in offspring mice through SERPINA3C; Authors - Yang Li
human	WB	J Med Chem; Discovery of Novel Phosphoinositide-3-Kinase α Inhibitors with High Selectivity, Excellent Bioavailability, and Long-Acting Efficacy for Gastric Cancer.; Authors - Yi Hou
human	WB	J Ethnopharmacol; Antitumor mechanism of kangliu pill on gliomas in mice through PI3K-Akt signaling pathway; Authors - Fei Chen
human	WB,IHC	Front Oncol; Relationship Between PTEN and Angiogenesis of Esophageal Squamous Cell Carcinoma and the Underlying Mechanism.; Authors - Chenbo Yang
human	WB	Bioorg Chem; Design, synthesis and biological evaluation of anilide (dicarboxylic acid) shikonin esters as antitumor agents through targeting PI3K/Akt/mTOR signaling pathway.; Authors - Yingying Ma
mouse	WB	Chin Med; Integrated metabolomics, network pharmacology and biological verification to reveal the mechanisms of Nauclea officinalis treatment of LPS-induced acute lung injury; Authors - Han Xu