Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, MCF-7 cells, SH-SY5Y cells, PC-12 cells |
| Positive IHC detected in | human lung cancer tissue, human colon cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67121-1-Ig targets PI3 Kinase p110 Beta in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse, rat, chicken, goat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17505 Product name: Recombinant human PIK3CB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-373 aa of BC114432 Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV Predict reactive species |
| Full Name | phosphoinositide-3-kinase, catalytic, beta polypeptide |
| Calculated Molecular Weight | 1070 aa, 123 kDa |
| Observed Molecular Weight | 120-130 kDa |
| GenBank Accession Number | BC114432 |
| Gene Symbol | PI3 Kinase p110 Beta |
| Gene ID (NCBI) | 5291 |
| RRID | AB_2882424 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P42338 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PI3 Kinase p110 Beta antibody 67121-1-Ig | Download protocol |
| IHC protocol for PI3 Kinase p110 Beta antibody 67121-1-Ig | Download protocol |
| WB protocol for PI3 Kinase p110 Beta antibody 67121-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PI3 Kinase p110 Beta Monoclonal antibody (catalog #67121-1-Ig) has 42 citations. These appear in journals including Cancer Discovery, Nature Metabolism, Biomaterials, Cancer Letters, Journal of Medicinal Chemistry, Cell Death Discovery, Journal of Translational Medicine, Frontiers in Oncology, Epigenomics, and Scientific Reports. Research fields span oncology (multiple cancer types and PI3K/AKT/mTOR signaling), metabolism, cardiovascular disease, neurology, inflammation, and traditional medicine mechanisms, primarily using Western blot, IHC, and IP applications.
| Species | Application | Title |
|---|---|---|
Cancer Discov PTEN Loss Promotes PI3Kβ Phosphorylation and EPHA2/SRC/p-PI3KβY962 Complex Assembly to Drive Tumorigenesis.
| ||
Nat Metab Maternal exercise prevents metabolic disorders in offspring mice through SERPINA3C | ||
Biomaterials Enhancing miR-19a/b induced cardiomyocyte proliferation in infarcted hearts by alleviating oxidant stress and controlling miR-19 release | ||
Cancer Lett TRDMT1-mediated mRNA m(5)C methylation decreases chemotherapy sensitivity by activating homologous recombination-mediated DNA damage repair and IRS2 expression in pancreatic cancer. | ||
Phytomedicine Unveiling XinJia-LuHuang Granules' protective mechanism against atherosclerosis: Integrating network pharmacology, metabolomics, and experimental validation | ||
Cell Death Discov MFGE8 promotes adult hippocampal neurogenesis in rats following experimental subarachnoid hemorrhage via modifying the integrin β3/Akt signaling pathway |
