CoraLite®555-conjugated PI3 Kinase p110 Beta Monoclonal antibody

PI3 Kinase p110 Beta Monoclonal Antibody for FC (Intra)

Cat No. CL555-67121
Clone No.1B2A1

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat

Applications

FC (Intra)

DKFZp779K1237, p110 BETA, PI3 Kinase p110 Beta, PI3 kinase subunit beta, PI3K, PI3K beta, PI3K p110(beta), PI3Kbeta, PI3KCB, PIK3C1, PIK3CB, PtdIns 3 kinase subunit beta

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-67121 targets PI3 Kinase p110 Beta in FC (Intra) applications and shows reactivity with Human, Rat samples.

Tested Reactivity Human, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17505

Product name: Recombinant human PIK3CB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 139-373 aa of BC114432

Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV

Predict reactive species
Full Name phosphoinositide-3-kinase, catalytic, beta polypeptide
Calculated Molecular Weight 1070 aa, 123 kDa
Observed Molecular Weight 120-130 kDa
GenBank Accession NumberBC114432
Gene Symbol PI3 Kinase p110 Beta
Gene ID (NCBI) 5291
RRIDAB_3084628
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP42338
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002).

Protocols

Product Specific Protocols
FC protocol for CL555 PI3 Kinase p110 Beta antibody CL555-67121Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...