Filter: AllWBIHCIF/ICC

WB analysis using 67121-1-Ig (same clone as 67121-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 67121-1-Ig (same clone as 67121-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 67121-1-Ig (same clone as 67121-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 67121-1-Ig (same clone as 67121-1-PBS)
MCF-7 cells were subjected to SDS PAGE followed by western blot with 67121-1-Ig (PIK3CB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67121-1-Ig (PIK3CB antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67121-1-Ig (PIK3CB antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human cervical cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 67121-1-Ig (same clone as 67121-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67121-1-Ig (PI3 Kinase p110 Beta antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 67121-1-Ig (same clone as 67121-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PI3 Kinase p110 Beta antibody (67121-1-Ig, Clone: 1B2A1 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), CL594-phalloidin (red). This data was developed using the same antibody clone with 67121-1-PBS in a different storage buffer formulation.

PI3 Kinase p110 Beta Monoclonal antibody, PBS Only

PI3 Kinase p110 Beta Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67121-1-PBS

Clone No.1B2A1

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PI3K p110(beta), PIK3CB, PI3K, PI3 kinase subunit beta, p110 BETA

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67121-1-PBS targets PI3 Kinase p110 Beta in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity	human, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag17505 Product name: Recombinant human PIK3CB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-373 aa of BC114432 Sequence: SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV Predict reactive species
Full Name	phosphoinositide-3-kinase, catalytic, beta polypeptide
Calculated Molecular Weight	1070 aa, 123 kDa
Observed Molecular Weight	120-130 kDa
GenBank Accession Number	BC114432
Gene Symbol	PI3 Kinase p110 Beta
Gene ID (NCBI)	5291
RRID	AB_2882424
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P42338
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

PIK3CB(phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform) is also named as PIK3C1, PI3K-beta, p110beta. The gene encodes a 1070 amino acid protein which belongs to the PI3/PI4-kinase family. Phosphoinositide 3-kinases (PI3Ks) have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. The class I PI3 kinases are heterodimers composed of 110 kDa catalytic subunits that associate with regulatory adaptor proteins. Four class I catalytic subunits have been identified, PIK3CA (p110α), PIK3CB (p110β), PIK3CD (p110δ) and PIK3CG (p110γ)(PMID:19177002).