PIN1 Monoclonal antibody

• 

  WB analysis using 68127-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68127-1-Ig (PIN1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IP experiment of HepG2 using 68127-1-Ig

  IP result of anti-PIN1 (IP:68127-1-Ig, 4ug; Detection:68127-1-Ig 1:2000) with HepG2 cells lysate 1920 ug.

• 

  IF Staining of NIH/3T3 using 68127-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using PIN1 antibody (68127-1-Ig, Clone: 1F4G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 68127-1-Ig

  Biolayer interferometry (BLl) kinetic assays of 68127-1-Ig against Human PIN1 were performed. The affinity constant is 2.48 nM.

PIN1 Monoclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 68127-1-Ig

Clone No.1F4G3

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, IP, ELISA

Synonyms

1F4G3, EC:5.2.1.8, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, Pin 1

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
• Positive IP detected in: HepG2 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

68127-1-Ig targets PIN1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0767

  Product name: Recombinant human PIN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC002899

  Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

• Full Name: peptidylprolyl cis/trans isomerase, NIMA-interacting 1
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC002899
• Gene Symbol: PIN1
• Gene ID (NCBI): 5300
• RRID: AB_2923654
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13526
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	bioRxiv; Shifts in protein aggregate stability define proteostasis decline in the aging human brain.; Authors - Edward Anderton