PIN1 Monoclonal antibody, PBS Only

PIN1 Monoclonal Antibody for WB, IF/ICC, IP, Indirect ELISA
Cat No. 68127-1-PBS
Clone No.1F4G3

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit, pig

Applications

WB, IF/ICC, IP, Indirect ELISA

DOD, PIN1, PPIase Pin1, Rotamase Pin1, UBL5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68127-1-PBS targets PIN1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

Tested Reactivity Human, mouse, rat, rabbit, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0767

Product name: Recombinant human PIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-163 aa of BC002899

Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Predict reactive species
Full Name peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Calculated Molecular Weight 18 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC002899
Gene Symbol PIN1
Gene ID (NCBI) 5300
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13526
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).

Loading...
||
New chat Able
正在加载,请稍候...