CoraLite® Plus 488-conjugated PIN1 Monoclonal antibody

PIN1 Monoclonal Antibody for IF/ICC

Cat No. CL488-68127
Clone No.1F4G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

IF/ICC

1F4G3, EC:5.2.1.8, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, Peptidyl-prolyl cis-trans isomerase Pin1, Pin 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68127 targets PIN1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0767

Product name: Recombinant human PIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-163 aa of BC002899

Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Predict reactive species
Full Name peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Calculated Molecular Weight 18 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC002899
Gene Symbol PIN1
Gene ID (NCBI) 5300
RRIDAB_3672973
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ13526
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PIN1 antibody CL488-68127Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...