CoraLite® Plus 488-conjugated PKC Zeta Polyclonal antibody

PKC Zeta Polyclonal Antibody for IF/ICC
Cat No. CL488-26899

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

PKC ZETA, PKC2, PRKCZ, Protein kinase C zeta type, protein kinase C, zeta

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells, HeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL488-26899 targets PKC Zeta in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25391

Product name: Recombinant human PRKCZ protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 171-245 aa of BC014270

Sequence: RCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQ

Predict reactive species
Full Name protein kinase C, zeta
Calculated Molecular Weight 80 kDa
Observed Molecular Weight 67 kDa
GenBank Accession NumberBC014270
Gene Symbol PKC Zeta
Gene ID (NCBI) 5590
RRIDAB_3084101
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ05513
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PKC Zeta antibody CL488-26899Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nat Commun

Targeted immunotherapy rescues pulmonary fibrosis by reducing activated fibroblasts and regulating alveolar cell profile

Authors - Jing Yan
Loading...
||
New chat Able
正在加载,请稍候...