PLN Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86080-1-RR (same clone as 86080-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86080-1-RR (PLN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86080-1-PBS in a different storage buffer formulation.

• 

  Affinity of 86080-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86080-1-RR against Human PLN were performed. The affinity constant is below 1 pM.

PLN Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86080-1-PBS

Clone No.250753E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CMD1P, PLB

---

Product Information

86080-1-PBS targets PLN in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8632

  Product name: Recombinant human PLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-52 aa of BC005269

  Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

• Full Name: phospholamban
• Calculated Molecular Weight: 52 aa, 6 kDa
• Observed Molecular Weight: 10 kDa, 25 kDa
• GenBank Accession Number: BC005269
• Gene Symbol: PLN
• Gene ID (NCBI): 5350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P26678
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Phospholamban (PLN) is a 52-amino-acid transmembrane protein found in the sarcoplasmic reticulum (SR) of cardiac muscle cells. It has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. Phospholamban has a homopentamer form(25-27 kDa).