CoraLite® Plus 750-conjugated PPAR Gamma Recombinant monoclonal antibody

PPAR Gamma Uni-rAb® Recombinant Antibody for WB, FC (Intra)

Cat No. CL750-81490-5
Clone No.230374A3

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, FC (Intra)

PPARG, 230374A3, NR1C3, Peroxisome proliferator-activated receptor gamma, PPAR-gamma

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, HepG2 cells, MCF-7 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-81490-5 targets PPAR Gamma in WB, FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10005

Product name: Recombinant human PPARG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 161-477 aa of BC006811

Sequence: KCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Predict reactive species
Full Name peroxisome proliferator-activated receptor gamma
Calculated Molecular Weight 58 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC006811
Gene Symbol PPARG
Gene ID (NCBI) 5468
RRIDAB_3673730
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP37231
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Peroxisome Proliferator-Activated Receptors (PPARs) are ligand-activated intracellular transcription factors, members of the nuclear hormone receptor superfamily (NR), that includes estrogen, thyroid hormone receptors, retinoic acid, Vitamin D3 as well as retinoid X receptors (RXRs). The PPAR subfamily consists of three subtypes encoded by distinct genes denoted PPARα (NR1C1), PPARβ/δ (NR1C2) and PPARγ (NR1C3), which are activated by selective ligands. PPARγ, also named as PPARG, contains one nuclear receptor DNA-binding domain and is a receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. It plays an important role in the regulation of lipid homeostasis, adipogenesis, ins resistance, and development of various organs. Defects in PPARG are the cause of familial partial lipodystrophy type 3 (FPLD3) and may be associated with susceptibility to obesity. Defects in PPARG can lead to type 2 ins-resistant diabetes and hypertension. PPARG mutations may be associated with colon cancer. Genetic variations in PPARG are associated with susceptibility to glioma type 1 (GLM1). PPARG has two isoforms with molecular weights of 57 kDa and 54 kDa (PMID: 9831621), but modified PPARG is about 67 KDa (PMID: 16809887). PPARG2 is a splice variant and has an additional 30 amino acids at the N-terminus (PMID: 15689403). Experimental data indicate that a 45 kDa protein displaying three different sequences immunologically related to the nuclear receptor PPARG2 is located in mitochondria (mt-PPAR). However, the molecular weight of this protein is clearly less when compared to that of PPARG2 (57 kDa) (PMID: 10922459). PPARG has been reported to be localized mainly (but not always) in the nucleus. PPARG can also be detected in the cytoplasm and was reported to possess extra-nuclear/non-genomic actions (PMID: 17611413; 19432669; 14681322).

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 PPAR Gamma antibody CL750-81490-5Download protocol
WB protocol for CL Plus 750 PPAR Gamma antibody CL750-81490-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...