Pancreatic Polypeptide Polyclonal antibody

• 

  IHC staining of mouse pancreas using 15493-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 15493-1-AP (Pancreatic Polypeptide antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 15493-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 15493-1-AP (Pancreatic Polypeptide antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat pancreas using 15493-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat pancreas tissue using Pancreatic Polypeptide antibody (15493-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), Pancreatic Polypeptide antibody (15493-1-AP, green) stained on PP cells in rat pancreas islet. Glucagon antibody (67286-1-Ig, Clone: 2A8G1, red) stained on α cells in rat pancreas islet.

• 

  IF Staining of rat pancreas using 15493-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat pancreas tissue using Pancreatic Polypeptide antibody (15493-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), Pancreatic Polypeptide antibody (15493-1-AP) (green) stained on PP cells in rat pancreas islet. Glucagon antibody (67286-1-Ig, Clone: 2A8G1, red) stained on α cells in rat pancreas islet.

• 

  FC experiment of HepG2 using 15493-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human Pancreatic Polypeptide (15493-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Pancreatic Polypeptide Polyclonal Antibody for IHC, IF-P, FC (Intra), ELISA

Cat No. 15493-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, FC (Intra), ELISA

Synonyms

PPY, PH, Pancreatic prohormone, Pancreatic polypeptide Y, Pancreatic polypeptide prohormone

---

Tested Applications

• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat pancreas tissue
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

15493-1-AP targets Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7886

  Product name: Recombinant human PPY protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC032225

  Sequence: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL

• Full Name: pancreatic polypeptide
• Calculated Molecular Weight: 10 kDa
• GenBank Accession Number: BC032225
• Gene Symbol: Pancreatic Polypeptide
• Gene ID (NCBI): 5539
• RRID: AB_2878145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01298
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Transpl Int; Formation of Re-Aggregated Neonatal Porcine Islet Clusters Improves In Vitro Function and Transplantation Outcome; Authors - M Honarpisheh
	IF	Vet Med Sci; Histology and immunofluorescent study of the pancreas in lovebird (Agapornis personatus); Authors - Nader Goodarzi
mouse	IF	Diabetes; Mettl3-Mediated m6A Methylation Controls Pancreatic Bipotent Progenitor Fate and Islet Formation; Authors - Jiajun Sun
		Cell Rep; A ONECUT1 regulatory, non-coding region in pancreatic development and diabetes; Authors - Sarah Merz