Tested Applications
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat pancreas tissue |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 1 publications below |
| IF | See 3 publications below |
Product Information
15493-1-AP targets Pancreatic Polypeptide in IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7886 Product name: Recombinant human PPY protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC032225 Sequence: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL Predict reactive species |
| Full Name | pancreatic polypeptide |
| Calculated Molecular Weight | 10 kDa |
| GenBank Accession Number | BC032225 |
| Gene Symbol | Pancreatic Polypeptide |
| Gene ID (NCBI) | 5539 |
| RRID | AB_2878145 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01298 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Pancreatic Polypeptide antibody 15493-1-AP | Download protocol |
| IF protocol for Pancreatic Polypeptide antibody 15493-1-AP | Download protocol |
| IHC protocol for Pancreatic Polypeptide antibody 15493-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) PPY-Induced iCAFs Cultivate an Immunosuppressive Microenvironment in Pancreatic Cancer | ||
Diabetes Mettl3-Mediated m6A Methylation Controls Pancreatic Bipotent Progenitor Fate and Islet Formation | ||
Transpl Int Formation of Re-Aggregated Neonatal Porcine Islet Clusters Improves In Vitro Function and Transplantation Outcome | ||
Vet Med Sci Histology and immunofluorescent study of the pancreas in lovebird (Agapornis personatus) |









