CoraLite® Plus 488-conjugated Pancreatic Polypeptide Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-15493

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 Pancreatic Polypeptide antibody (CL488-15493) at dilution of 1:200.

Pancreatic Polypeptide Polyclonal Antibody for IF/ICC

Cat No. CL488-15493

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Obinepitide, pancreatic polypeptide, Pancreatic prohormone, PH Pancreatic icosapeptide, PI, PNP, PP, PPY

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15493 targets Pancreatic Polypeptide in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7886

  Product name: Recombinant human PPY protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC032225

  Sequence: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL

• Full Name: pancreatic polypeptide
• Calculated Molecular Weight: 10 kDa
• GenBank Accession Number: BC032225
• Gene Symbol: Pancreatic Polypeptide
• Gene ID (NCBI): 5539
• RRID: AB_3083970
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01298
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.