• Featured Product
  • KD/KO Validated

PSMD9 Monoclonal antibody, PBS Only

PSMD9 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 67338-1-PBS
Clone No.1H2G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

1H2G1, 26S proteasome non-ATPase regulatory subunit 9, p27, Rpn4

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67338-1-PBS targets PSMD9 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25654

Product name: Recombinant human PSMD9 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-102 aa of BC004213

Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC004213
Gene Symbol PSMD9
Gene ID (NCBI) 5715
RRIDAB_2882596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO00233
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex.

Loading...
||
New chat Able
正在加载,请稍候...