• Featured Product
  • KD/KO Validated

PSMD9 Monoclonal antibody

PSMD9 Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 67338-1-Ig
Clone No.1H2G1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

1H2G1, 26S proteasome non-ATPase regulatory subunit 9, p27, Rpn4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, NIH/3T3 cells, HSC-T6 cells, K-562 cells, Jurkat cells, LNCaP cells, HeLa cells, 4T1 cells, HepG2 cells
Positive IF/ICC detected inU2OS cells, HeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67338-1-Ig targets PSMD9 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25654

Product name: Recombinant human PSMD9 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-102 aa of BC004213

Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC004213
Gene Symbol PSMD9
Gene ID (NCBI) 5715
RRIDAB_2882596
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO00233
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex.

Protocols

Product Specific Protocols
FC protocol for PSMD9 antibody 67338-1-IgDownload protocol
IF protocol for PSMD9 antibody 67338-1-IgDownload protocol
WB protocol for PSMD9 antibody 67338-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pigIF

J Virol

Swine RNF5 positively regulates the antiviral activity of IFITM1 by mediating the degradation of ABHD16A

Authors - Xuemeng Shi
humanWB,IHC,IF

CNS Neurosci Ther

Comprehensive analysis of PSMD family members and validation of PSMD9 as a potential therapeutic target in human glioblastoma

Authors - Yaquan Li
Loading...
||
New chat Able
正在加载,请稍候...