Tested Applications
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-67466 targets PSMG3 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8384 Product name: Recombinant human PSMG3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-122 aa of BC004308 Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW Predict reactive species |
| Full Name | proteasome (prosome, macropain) assembly chaperone 3 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC004308 |
| Gene Symbol | PSMG3 |
| Gene ID (NCBI) | 84262 |
| RRID | AB_3672950 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BT73 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PSMG3, also named as C7orf48 and PAC3, is a chaperone protein which promotes assembly of the 20S proteasome. It may cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 PSMG3 antibody CL488-67466 | Download protocol |
| IF protocol for CL Plus 488 PSMG3 antibody CL488-67466 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



