Product Information
83421-1-PBS targets PTDSS1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14170 Product name: Recombinant human PTDSS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 394-473 aa of BC002376 Sequence: TTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK Predict reactive species |
| Full Name | phosphatidylserine synthase 1 |
| Calculated Molecular Weight | 473 aa, 56 kDa |
| GenBank Accession Number | BC002376 |
| Gene Symbol | PTDSS1 |
| Gene ID (NCBI) | 9791 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P48651 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Phosphatidylserine Synthase-1 (PTDSS1 or PSS1) is one of two enzymes involved in the production of phosphatidylserine (PS), which is a quantitatively minor, but physiologically important phospholipid in mammalian cells (PMID: 24241535). Mice lacking either Ptdss1 or Ptdss2 are viable, phenotypically normal and fertile, indicating that, in mice, PSS1 and PSS2 can compensate for each other (PMID: 18343815).





