PTDSS1 Recombinant monoclonal antibody

• 

  IF Staining of Hela using 83421-1-RR

  Immunofluorescent analysis of (4% PFA) fixed Hela cells using PTDSS1 antibody (83421-1-RR, Clone: 240007G3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HepG2 using 83421-1-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug PTDSS1 Recombinant antibody (83421-1-RR, Clone:240007G3) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83421-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83421-1-RR against Human PTDSS1 were performed. The affinity constant is below 1 pM.

PTDSS1 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83421-1-RR

Clone No.240007G3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

PSS1, 240007G3, EC:2.7.8.29, KIAA0024, Phosphatidylserine synthase 1

---

Tested Applications

• Positive IF/ICC detected in: Hela cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83421-1-RR targets PTDSS1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14170

  Product name: Recombinant human PTDSS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 394-473 aa of BC002376

  Sequence: TTFLCLYGMIWYAEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK

• Full Name: phosphatidylserine synthase 1
• Calculated Molecular Weight: 473 aa, 56 kDa
• GenBank Accession Number: BC002376
• Gene Symbol: PTDSS1
• Gene ID (NCBI): 9791
• RRID: AB_3671070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P48651
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Phosphatidylserine Synthase-1 (PTDSS1 or PSS1) is one of two enzymes involved in the production of phosphatidylserine (PS), which is a quantitatively minor, but physiologically important phospholipid in mammalian cells (PMID: 24241535). Mice lacking either Ptdss1 or Ptdss2 are viable, phenotypically normal and fertile, indicating that, in mice, PSS1 and PSS2 can compensate for each other (PMID: 18343815).