Product Information
84399-3-PBS targets PURG in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag15820 Product name: Recombinant human PURG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 125-182 aa of BC106708 Sequence: HYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRK Predict reactive species |
| Full Name | purine-rich element binding protein G |
| Calculated Molecular Weight | 347 aa, 40 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC106708 |
| Gene Symbol | PURG |
| Gene ID (NCBI) | 29942 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9UJV8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PURG (Purine-rich element-binding protein G) is a member of the PUR protein family. It has 2 isoforms with a molecular weight of 37-40 kDa.





