PURG Recombinant monoclonal antibody

• 

  WB analysis using 84399-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84399-3-RR (PURG antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 84399-3-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PURG antibody (84399-3-RR, Clone: 241504E7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 84399-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84399-3-RR against Human PURG were performed. The affinity constant is 0.328 nM.

PURG Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 84399-3-RR

Clone No.241504E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

241504E7, PURG A, PURG B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84399-3-RR targets PURG in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15820

  Product name: Recombinant human PURG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-182 aa of BC106708

  Sequence: HYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRK

• Full Name: purine-rich element binding protein G
• Calculated Molecular Weight: 347 aa, 40 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC106708
• Gene Symbol: PURG
• Gene ID (NCBI): 29942
• RRID: AB_3671929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UJV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PURG (Purine-rich element-binding protein G) is a member of the PUR protein family. It has 2 isoforms with a molecular weight of 37-40 kDa.