Filter:
Tested Applications
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-84399-3 targets PURG in IF/ICC applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag15820 Product name: Recombinant human PURG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 125-182 aa of BC106708 Sequence: HYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRK Predict reactive species |
| Full Name | purine-rich element binding protein G |
| Calculated Molecular Weight | 347 aa, 40 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC106708 |
| Gene Symbol | PURG |
| Gene ID (NCBI) | 29942 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UJV8 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
PURG (Purine-rich element-binding protein G) is a member of the PUR protein family. It has 2 isoforms with a molecular weight of 37-40 kDa.
