Podoplanin Recombinant monoclonal antibody

Podoplanin Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 86750-2-RR
Clone No.251406B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

PDPN, 29kDa cytosolic podoplanin intracellular domain, Aggrus, PA2.26 antigen, PSEC0003

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, HEK-293 cells, MG-63 cells, human placenta tissue
Positive IHC detected inhuman tonsil tissue, human appendix tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86750-2-RR targets Podoplanin in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg5024

Product name: Recombinant Human Podoplanin protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 23-131 aa of BC014668

Sequence: ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL

Predict reactive species
Full Name podoplanin
Observed Molecular Weight36-43 kDa
GenBank Accession NumberBC014668
Gene Symbol Podoplanin
Gene ID (NCBI) 10630
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ86YL7-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Podoplanin was identified as a 43 kDa glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.

Protocols

Product Specific Protocols
IHC protocol for Podoplanin antibody 86750-2-RRDownload protocol
WB protocol for Podoplanin antibody 86750-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...