Podoplanin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86750-2-RR (same clone as 86750-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86750-2-RR (PDPN antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86750-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsil using 86750-2-RR (same clone as 86750-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 86750-2-RR (Podoplanin antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86750-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsil using 86750-2-RR (same clone as 86750-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 86750-2-RR (Podoplanin antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86750-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendix using 86750-2-RR (same clone as 86750-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendix tissue slide using 86750-2-RR (PDPN antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86750-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human appendix using 86750-2-RR (same clone as 86750-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendix tissue slide using 86750-2-RR (PDPN antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86750-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 86750-2-RR (same clone as 86750-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86750-2-RR (PDPN antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86750-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 86750-2-RR (same clone as 86750-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86750-2-RR (PDPN antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86750-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86750-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86750-2-RR against Human Podoplanin were performed. The affinity constant is 0.975 nM.

Podoplanin Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86750-2-PBS

Clone No.251406B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

PDPN, 29kDa cytosolic podoplanin intracellular domain, Aggrus, PA2.26 antigen, PSEC0003

---

Product Information

86750-2-PBS targets Podoplanin in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5024

  Product name: Recombinant Human Podoplanin protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-131 aa of BC014668

  Sequence: ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL

• Full Name: podoplanin
• Observed Molecular Weight: 36-43 kDa
• GenBank Accession Number: BC014668
• Gene Symbol: Podoplanin
• Gene ID (NCBI): 10630
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86YL7-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Podoplanin was identified as a 43 kDa glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.