CoraLite® Plus 488-conjugated Podoplanin Recombinant monoclonal antibody

• 

  IF Staining of mouse kidney using CL488-86750-2

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using CoraLite® Plus 488 Podoplanin antibody (CL488-86750-2, Clone: 251406B11 ) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Podoplanin Uni-rAb^® Recombinant Antibody for IF-P

Cat No. CL488-86750-2

Clone No.251406B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P

Synonyms

PDPN, 29kDa cytosolic podoplanin intracellular domain, Aggrus, PA2.26 antigen, PSEC0003

---

Tested Applications

• Positive IF-P detected in: mouse kidney tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86750-2 targets Podoplanin in IF-P applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5024

  Product name: Recombinant Human Podoplanin protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-131 aa of BC014668

  Sequence: ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL

• Full Name: podoplanin
• Observed Molecular Weight: 36-43 kDa
• GenBank Accession Number: BC014668
• Gene Symbol: Podoplanin
• Gene ID (NCBI): 10630
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86YL7-1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Podoplanin was identified as a 43 kDa glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels.