• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated RAB27B Polyclonal antibody

RAB27B Polyclonal Antibody for FC (Intra)

Cat No. CL647-13412

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

C25KG, EC:3.6.5.2, Ras related protein Rab 27B, Ras-related protein Rab-27B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA431 cells, HeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.8 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-13412 targets RAB27B in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4064

Product name: Recombinant human RAB27B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-218 aa of BC027474

Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Predict reactive species
Full Name RAB27B, member RAS oncogene family
Calculated Molecular Weight 218 aa, 25 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC027474
Gene Symbol RAB27B
Gene ID (NCBI) 5874
RRIDAB_3673569
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00194
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The Rab27 GTPase subfamily consists of two closely related homologs, Rab27a and Rab27b. Northern blot analysis revealed that Rab27b is expressed significantly only in testis, in which the predominant transcript was 1.4 kb in size. An 8-kb mRNA of unknown origin was detected in many tissues. Rab27b is associated with tubulovesicle membranes in the parietal cell and Rab27b may play a role in stimulation-associated membrane recruitment and gastric acid secretion. Rab27b is recently reported as a marker for breast cancer progression. It regulates invasive growth and metastasis in ER-positive breast cancer cell lines, and increased expression is associated with poor prognosis in humans.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 RAB27B antibody CL647-13412Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...