Tested Applications
| Positive IF-P detected in | human lung cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-67094 targets RALB in IF-P applications and shows reactivity with Human, rat, pig, mouse samples.
| Tested Reactivity | Human, rat, pig, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28600 Product name: Recombinant human RALB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-206 aa of BC018163 Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL Predict reactive species |
| Full Name | v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) |
| Calculated Molecular Weight | 206 aa, 23 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC018163 |
| Gene Symbol | RALB |
| Gene ID (NCBI) | 5899 |
| RRID | AB_2920085 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P11234 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 RALB antibody CL594-67094 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

