RALB Monoclonal antibody

RALB Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 67094-1-Ig
Clone No.1D11C11

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

RALB, Ras related protein Ral B

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, rat brain tissue, mouse brain tissue, MCF-7 cells, HepG2 cells, Jurkat cells, Pig brain cells
Positive IHC detected inmouse bladder tissue, human lung cancer tissue, mouse liver tissue, mouse lung tissue, mouse placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lung cancer tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67094-1-Ig targets RALB in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.

Tested Reactivity Human, rat, pig, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Affinity
KD=1.82 x 10-10M
KOff=2.54 x 10-6M
KOn=1.40 x 104M
Immunogen

CatNo: Ag28600

Product name: Recombinant human RALB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-206 aa of BC018163

Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

Predict reactive species
Full Name v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
Calculated Molecular Weight 206 aa, 23 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC018163
Gene Symbol RALB
Gene ID (NCBI) 5899
RRIDAB_2882399
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP11234
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for RALB antibody 67094-1-IgDownload protocol
IHC protocol for RALB antibody 67094-1-IgDownload protocol
WB protocol for RALB antibody 67094-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Hum Pathol

Papillary renal neoplasm with reverse polarity: a clinicopathologic study of 43 cases with a focus on the expression of KRAS signaling pathway downstream effectors

Authors - Bohyun Kim
humanIF

Cancers (Basel)

Controlled Plasma Membrane Delivery of FGFR1 and Modulation of Signaling by a Novel Regulated Anterograde RTK Transport Pathway

Authors - Claire Leist Hinsch
Loading...
||
New chat Able
正在加载,请稍候...