RALB Monoclonal antibody

• 

  WB analysis using 67094-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 67094-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 67094-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 67094-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67094-1-Ig (RALB antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse placenta using 67094-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse placenta tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse bladder using 67094-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 67094-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 67094-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 67094-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67094-1-Ig (RALB antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human lung cancer using 67094-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human lung cancer tissue using RALB antibody (67094-1-Ig, Clone: 1D11C11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

RALB Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67094-1-Ig

Clone No.1D11C11

Publications(2)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

RALB, Ras related protein Ral B

---

Tested Applications

• Positive WB detected in: HeLa cells, rat brain tissue, mouse brain tissue, MCF-7 cells, HepG2 cells, Jurkat cells, Pig brain cells
• Positive IHC detected in: mouse bladder tissue, human lung cancer tissue, mouse liver tissue, mouse lung tissue, mouse placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human lung cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

67094-1-Ig targets RALB in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.

• Tested Reactivity: Human, rat, pig, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Affinity:
  K_D=1.82 x 10^-10M
  K_Off=2.54 x 10^-6M
  K_On=1.40 x 10^4M
• Immunogen:

  CatNo: Ag28600

  Product name: Recombinant human RALB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-206 aa of BC018163

  Sequence: MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL

• Full Name: v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
• Calculated Molecular Weight: 206 aa, 23 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC018163
• Gene Symbol: RALB
• Gene ID (NCBI): 5899
• RRID: AB_2882399
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11234
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Hum Pathol; Papillary renal neoplasm with reverse polarity: a clinicopathologic study of 43 cases with a focus on the expression of KRAS signaling pathway downstream effectors; Authors - Bohyun Kim
human	IF	Cancers (Basel); Controlled Plasma Membrane Delivery of FGFR1 and Modulation of Signaling by a Novel Regulated Anterograde RTK Transport Pathway; Authors - Claire Leist Hinsch