CoraLite® Plus 594-conjugated RanGAP1 Monoclonal antibody

• 

  IF Staining of HepG2 using CL594-67146

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 594 RANGAP1 antibody (CL594-67146, Clone: 1F3A4 ) at dilution of 1:1000.

• 

  FC experiment of HepG2 using CL594-67146

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug CoraLite® Plus 594-conjugated RANGAP1 Monoclonal antibody (CL594-67146, Clone:1F3A4)(red), or 0.8 ug CoraLite®594 Mouse IgG1 Isotype Control (1F8D3) (CL594-66360-1, Clone: 1F8D3) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

RanGAP1 Monoclonal Antibody for IF/ICC

Cat No. CL594-67146

Clone No.1F3A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

1F3A4, KIAA1835, Ran GTPase-activating protein 1, SD

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67146 targets RanGAP1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26136

  Product name: Recombinant human RANGAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-220 aa of BC014044

  Sequence: ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI

• Full Name: Ran GTPase activating protein 1
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64 kDa, 82 kDa
• GenBank Accession Number: BC014044
• Gene Symbol: RANGAP1
• Gene ID (NCBI): 5905
• RRID: AB_3084753
• Conjugate: CoraLite® Plus 594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 594 nm / 615 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46060
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RanGAP1 is a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO) targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC) where it forms a complex with RanBP2 and Ubc9. Phosphorylation of RanGAP1 occurs in a cell-cycle-dependent manner and may play a role in regulating RanGAP1 catalytic activity. We got 64 kDa (cytoplasmic Ran GAP1) and 82 kDa (SUMO-1 modified Ran GAP1) in western blotting.