CoraLite® Plus 594-conjugated RanGAP1 Monoclonal antibody

RanGAP1 Monoclonal Antibody for IF/ICC

Cat No. CL594-67146
Clone No.1F3A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

1F3A4, KIAA1835, Ran GTPase-activating protein 1, SD

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67146 targets RanGAP1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26136

Product name: Recombinant human RANGAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2-220 aa of BC014044

Sequence: ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI

Predict reactive species
Full Name Ran GTPase activating protein 1
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 64 kDa, 82 kDa
GenBank Accession NumberBC014044
Gene Symbol RANGAP1
Gene ID (NCBI) 5905
RRIDAB_3084753
Conjugate CoraLite® Plus 594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths594 nm / 615 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46060
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RanGAP1 is a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO) targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC) where it forms a complex with RanBP2 and Ubc9. Phosphorylation of RanGAP1 occurs in a cell-cycle-dependent manner and may play a role in regulating RanGAP1 catalytic activity. We got 64 kDa (cytoplasmic Ran GAP1) and 82 kDa (SUMO-1 modified Ran GAP1) in western blotting.

Protocols

Product Specific Protocols
FC protocol for CL Plus 594 RanGAP1 antibody CL594-67146Download protocol
IF protocol for CL Plus 594 RanGAP1 antibody CL594-67146Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...