Tested Applications
| Positive WB detected in | HEK-293 cells, mouse adipose tissue | 
| Positive IP detected in | HEK-293 cells | 
| Positive IHC detected in | human colon cancer tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF-P detected in | human kidney tissue, human colon cancer tissue | 
| Positive IF/ICC detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 | 
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
14541-1-AP targets RBP7 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag6045 Product name: Recombinant human RBP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC063013 Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA Predict reactive species | 
                                    
| Full Name | retinol binding protein 7, cellular | 
| Calculated Molecular Weight | 15.5 kDa | 
| Observed Molecular Weight | 15-18 kDa | 
| GenBank Accession Number | BC063013 | 
| Gene Symbol | RBP7 | 
| Gene ID (NCBI) | 116362 | 
| RRID | AB_2179293 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q96R05 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RBP7 antibody 14541-1-AP | Download protocol | 
| IHC protocol for RBP7 antibody 14541-1-AP | Download protocol | 
| IP protocol for RBP7 antibody 14541-1-AP | Download protocol | 
| WB protocol for RBP7 antibody 14541-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

















