CoraLite®594-conjugated RBP7 Polyclonal antibody

• 

  IF Staining of human kidney using CL594-14541

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using CoraLite®594 RBP7 antibody (CL594-14541) at dilution of 1:200.

RBP7 Polyclonal Antibody for IF-P

Cat No. CL594-14541

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

Synonyms

CRABP IV, CRABP4, CRBP4, CRBPIV, RBP7, Retinoid binding protein 7

---

Tested Applications

• Positive IF-P detected in: human kidney tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-14541 targets RBP7 in IF-P applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6045

  Product name: Recombinant human RBP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-134 aa of BC063013

  Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

• Full Name: retinol binding protein 7, cellular
• Calculated Molecular Weight: 15.5 kDa
• Observed Molecular Weight: 15-18 kDa
• GenBank Accession Number: BC063013
• Gene Symbol: RBP7
• Gene ID (NCBI): 116362
• RRID: AB_2919810
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96R05
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.