CoraLite® Plus 488-conjugated RFX1 Monoclonal antibody

RFX1 Monoclonal Antibody for FC (Intra)
Cat No. CL488-68057
Clone No.1G10H6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

FC (Intra)

RFX, EF-C, EF C, 1G10H6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68057 targets RFX1 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25442

Product name: Recombinant human RFX1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 62-289 aa of BC049826

Sequence: QPQAQPPGGQKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQGTQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSPVQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQQLQQVPVPH

Predict reactive species
Full Name regulatory factor X, 1 (influences HLA class II expression)
Calculated Molecular Weight 105 kDa
Observed Molecular Weight135 kDa
GenBank Accession NumberBC049826
Gene Symbol RFX1
Gene ID (NCBI) 5989
RRIDAB_2923874
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP22670
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RFX1, also named as MHC class II regulatory factor RFX1, is a 979 amino acid protein which contains 1 RFX-type winged-helix DNA-binding domain and belongs to the RFX family. RFX1 can binds DNA as a homodimer and heterodimerizes with RFX2 and RFX3. RFX1 as a regulatory factor is essential for MHC class II genes expression. RFX1 protein is modified after translation and its molecular weight could be migrate to 130-140 kDa (PMID: 20189986 ).

Loading...
||
New chat Able
正在加载,请稍候...