• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated RRM1 Monoclonal antibody

RRM1 Monoclonal Antibody for IF/ICC, IF-P, FC (Intra)
Cat No. CL488-60073
Clone No.5H6F3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC, IF-P, FC (Intra)

RIR1, ribonucleotide reductase M1, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleoside-diphosphate reductase large subunit, EC:1.17.4.1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman breast cancer tissue
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60073 targets RRM1 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0789

Product name: Recombinant human RRM1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 593-792 aa of BC006498

Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

Predict reactive species
Full Name ribonucleotide reductase M1
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC006498
Gene Symbol RRM1
Gene ID (NCBI) 6240
RRIDAB_2883095
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23921
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival(PMID:17314339).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RRM1 antibody CL488-60073Download protocol
FC protocol for CL Plus 488 RRM1 antibody CL488-60073Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...