CoraLite® Plus 488-conjugated RRM1 Monoclonal antibody

• 

  IF Staining of human breast cancer using CL488-60073

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using CoraLite® Plus 488 RRM1 antibody (CL488-60073, Clone: 5H6F3 ) at dilution of 1:200.

• 

  IF Staining of HepG2 using CL488-60073

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 RRM1 antibody (CL488-60073, Clone: 5H6F3 ) at dilution of 1:200.

• 

  FC experiment of HepG2 using CL488-60073

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human RRM1 (CL488-60073, Clone:5H6F3) (red), or 0.4 ug Mouse IgG2b Isotype Control (CL488-66360-3, Clone: K11B8C4B5) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

RRM1 Monoclonal Antibody for IF/ICC, IF-P, FC (Intra)

Cat No. CL488-60073

Clone No.5H6F3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

IF/ICC, IF-P, FC (Intra)

Synonyms

RIR1, ribonucleotide reductase M1, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleoside-diphosphate reductase large subunit, EC:1.17.4.1

---

Tested Applications

• Positive IF-P detected in: human breast cancer tissue
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-60073 targets RRM1 in IF/ICC, IF-P, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0789

  Product name: Recombinant human RRM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 593-792 aa of BC006498

  Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

• Full Name: ribonucleotide reductase M1
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC006498
• Gene Symbol: RRM1
• Gene ID (NCBI): 6240
• RRID: AB_2883095
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23921
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival(PMID:17314339).